Loading...
Statistics
Advertisement

Willkommen bei PPE-Trading
www.ppe-trading.ch/

Ppe-trading.ch

Advertisement
Conversion Technology Metas Server
Ppe-trading.ch is hosted in Switzerland / Zurich . Ppe-trading.ch uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/2.4.

Technologies in use by Ppe-trading.ch

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache/2.4

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Ppe-trading.ch

SSL certificate

    • name: /C=CH/ST=SG/L=Rapperswil/O=Hostpoint AG/CN=sl62.web.hostpoint.ch/emailAddress=support@hostpoint.ch
    • subject:
      • C: CH
      • ST: SG
      • L: Rapperswil
      • O: Hostpoint AG
      • CN: sl62.web.hostpoint.ch
      • emailAddress: support@hostpoint.ch
    • hash: fd21e44a
    • issuer:
      • C: CH
      • ST: SG
      • L: Rapperswil
      • O: Hostpoint GmbH
      • CN: hostpoint.ch
      • emailAddress: support@hostpoint.ch
    • version: 2
    • serialNumber: 1228
    • validFrom: 150623130648Z
    • validTo: 200621130648Z
    • validFrom_time_t: 1435064808
    • validTo_time_t: 1592744808
    • extensions:
      • basicConstraints: CA:FALSE
      • nsComment: OpenSSL Generated Certificate
      • subjectKeyIdentifier: AA:12:78:B3:45:2B:82:C3:BA:17:EE:C1:3C:53:8C:25:A2:DD:1C:05
      • authorityKeyIdentifier: keyid:3D:27:D9:D4:DF:44:9C:73:B1:4A:F3:91:62:CF:3B:EA:83:C3:59:DE DirName:/C=CH/ST=SG/L=Rapperswil/O=Hostpoint GmbH/CN=hostpoint.ch/emailAddress=support@hostpoint.ch serial:00

Meta - Ppe-trading.ch

Number of occurences: 10
  • Name:
    Content: de
  • Name: GENERATOR
    Content: Macromedia UltraDev 4.01
  • Name: KEYWORDS
    Content: Packer,Bohrpacker,Klebepacker,Injektionspacker,Hochdruckpacker, Hochdruckbohrpacker,Niederdruckpacker,Niederdruck-Klebepacker,Nippelpacker,Injektionsnippel, Zementinjektion,Kunstharzinjektion,Betonverpressung,Rissverpressung,Rissinjektion,Rissabdichtung, EP-Injektion,PUR-Injektion,EP,PUR,Zürich,Regensdorf,Jaun,PPE,PPE-Trading,Bau,Sarnierungen,Beton
  • Name: AUTHOR
    Content: Patrick Staeheli - Internet-Factory
  • Name: LANGUAGE
    Content: de
  • Name: PUBLISHER
    Content: Internet-Factory CH-8105 Regensdorf
  • Name: COPYRIGHT
    Content: PPE-Trading CH-8105 Regensdorf
  • Name: RATING
    Content: general
  • Name: REVISIT-AFTER
    Content: 7 days
  • Name: ROBOTS
    Content: Default, Follow

Server / Hosting

  • IP: 217.26.52.41
  • Latitude: 47.37
  • Longitude: 8.55
  • Country: Switzerland
  • City: Zurich

Rname

  • ns3.hostpoint.ch
  • ns2.hostpoint.ch
  • ns.hostpoint.ch
  • mx2.mail.hostpoint.ch
  • mx1.mail.hostpoint.ch

Target

  • hostmaster.hostpoint.ch

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 10 Jul 2016 03:10:56 GMT Server: Apache/2.4 Last-Modified: Fri, 23 Nov 2007 09:58:29 GMT ETag: "2baa-43f95a80ddb40" Accept-Ranges: bytes Content-Length: 11178 Content-Type: text/html X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

DNS

host: ppe-trading.ch
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 217.26.52.41
host: ppe-trading.ch
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns3.hostpoint.ch
host: ppe-trading.ch
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns2.hostpoint.ch
host: ppe-trading.ch
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns.hostpoint.ch
host: ppe-trading.ch
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns.hostpoint.ch
  5. rname: hostmaster.hostpoint.ch
  6. serial: 2014121101
  7. refresh: 14400
  8. retry: 1800
  9. expire: 604800
  10. minimum-ttl: 3600
host: ppe-trading.ch
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mx2.mail.hostpoint.ch
host: ppe-trading.ch
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mx1.mail.hostpoint.ch

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.pe-trading.ch, www.pipe-trading.ch, www.ipe-trading.ch, www.pkpe-trading.ch, www.kpe-trading.ch, www.pupe-trading.ch, www.upe-trading.ch, www.pjpe-trading.ch, www.jpe-trading.ch, www.plpe-trading.ch, www.lpe-trading.ch, www.pe-trading.ch, www.ppie-trading.ch, www.pie-trading.ch, www.ppke-trading.ch, www.pke-trading.ch, www.ppue-trading.ch, www.pue-trading.ch, www.ppje-trading.ch, www.pje-trading.ch, www.pple-trading.ch, www.ple-trading.ch, www.pp-trading.ch, www.ppex-trading.ch, www.ppx-trading.ch, www.ppes-trading.ch, www.pps-trading.ch, www.ppew-trading.ch, www.ppw-trading.ch, www.pper-trading.ch, www.ppr-trading.ch, www.ppef-trading.ch, www.ppf-trading.ch, www.ppev-trading.ch, www.ppv-trading.ch, www.ppec-trading.ch, www.ppc-trading.ch, www.ppeq-trading.ch, www.ppq-trading.ch, www.ppea-trading.ch, www.ppa-trading.ch, www.ppey-trading.ch, www.ppy-trading.ch, www.ppetrading.ch, www.ppe-ttrading.ch, www.ppettrading.ch, www.ppe-gtrading.ch, www.ppegtrading.ch, www.ppe-htrading.ch, www.ppehtrading.ch, www.ppe-utrading.ch, www.ppeutrading.ch, www.ppe-jtrading.ch, www.ppejtrading.ch, www.ppe-xtrading.ch, www.ppextrading.ch, www.ppe-strading.ch, www.ppestrading.ch, www.ppe-atrading.ch, www.ppeatrading.ch, www.ppe-trading.ch, www.ppetrading.ch, www.ppe- trading.ch, www.ppe trading.ch, www.ppe-rading.ch, www.ppe-tqrading.ch, www.ppe-qrading.ch, www.ppe-tarading.ch, www.ppe-arading.ch, www.ppe-t rading.ch, www.ppe- rading.ch, www.ppe-twrading.ch, www.ppe-wrading.ch, www.ppe-terading.ch, www.ppe-erading.ch, www.ppe-tzrading.ch, www.ppe-zrading.ch, www.ppe-txrading.ch, www.ppe-xrading.ch, www.ppe-tcrading.ch, www.ppe-crading.ch, www.ppe-tading.ch, www.ppe-triading.ch, www.ppe-tiading.ch, www.ppe-troading.ch, www.ppe-toading.ch, www.ppe-trlading.ch, www.ppe-tlading.ch, www.ppe-trlading.ch, www.ppe-tlading.ch, www.ppe-tr.ading.ch, www.ppe-t.ading.ch, www.ppe-trding.ch, www.ppe-traoding.ch, www.ppe-troding.ch, www.ppe-trapding.ch, www.ppe-trpding.ch, www.ppe-tra9ding.ch, www.ppe-tr9ding.ch, www.ppe-trading.ch, www.ppe-trding.ch, www.ppe-traiding.ch, www.ppe-triding.ch, www.ppe-trauding.ch, www.ppe-truding.ch, www.ppe-traing.ch, www.ppe-tradting.ch, www.ppe-trating.ch, www.ppe-tradging.ch, www.ppe-traging.ch, www.ppe-tradbing.ch, www.ppe-trabing.ch, www.ppe-tradxing.ch, www.ppe-traxing.ch, www.ppe-tradsing.ch, www.ppe-trasing.ch, www.ppe-tradfing.ch, www.ppe-trafing.ch, www.ppe-tradving.ch, www.ppe-traving.ch, www.ppe-tradying.ch, www.ppe-traying.ch, www.ppe-tradzing.ch, www.ppe-trazing.ch, www.ppe-tradaing.ch, www.ppe-traaing.ch, www.ppe-tradeing.ch, www.ppe-traeing.ch, www.ppe-tradring.ch, www.ppe-traring.ch, www.ppe-tradng.ch, www.ppe-tradirng.ch, www.ppe-tradrng.ch, www.ppe-tradifng.ch, www.ppe-tradfng.ch, www.ppe-tradivng.ch, www.ppe-tradvng.ch, www.ppe-tradikng.ch, www.ppe-tradkng.ch, www.ppe-tradi,ng.ch, www.ppe-trad,ng.ch, www.ppe-tradibng.ch, www.ppe-tradbng.ch, www.ppe-tradigng.ch, www.ppe-tradgng.ch, www.ppe-traditng.ch, www.ppe-tradtng.ch, www.ppe-tradiyng.ch, www.ppe-tradyng.ch, www.ppe-tradiung.ch, www.ppe-tradung.ch, www.ppe-tradijng.ch, www.ppe-tradjng.ch, www.ppe-tradimng.ch, www.ppe-tradmng.ch, www.ppe-tradinng.ch, www.ppe-tradnng.ch, www.ppe-tradig.ch, www.ppe-tradinng.ch, www.ppe-trading.ch, www.ppe-tradinhg.ch, www.ppe-tradihg.ch, www.ppe-tradinjg.ch, www.ppe-tradijg.ch, www.ppe-tradinkg.ch, www.ppe-tradikg.ch, www.ppe-tradinlg.ch, www.ppe-tradilg.ch, www.ppe-tradin g.ch, www.ppe-tradi g.ch,

Other websites we recently analyzed

  1. J Collins Kerr | www.jcollinskerr.com | Home
    Beaverton (United States) - 67.51.200.171
    Server software:
    Technology: CSS, Html, Javascript, jQuery UI, Share This Social Media Buttons
    Number of Javascript: 9
    Number of meta tags: 3
  2. valentinesdaywishesmessagespics.com
    Scottsdale (United States) - 104.238.72.112
    Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  3. Kumruoğlu Nakliyat Lojistik Ambarcılık - www.kumruoglu.com.tr
    Kumruoğlu Nakliyat Lojistik Ambarcılık
    Turkey - 94.73.147.80
    Server software: nginx/1.1.19
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery UI
    Number of Javascript: 21
    Number of meta tags: 2
  4. giovannimurray.com
    Wayne (United States) - 74.208.165.84
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  5. W-Didacte.be
    Denmark - 46.30.212.21
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  6. your-coaching-concept.net
    Hier entsteht
    Germany - 89.31.143.16
    Server software: Apache
    Technology: CSS, Html, SVG
    Number of meta tags: 3
  7. express-airports.com
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  8. novosconfidentes.com.br
    Porto Alegre (Brazil) - 189.38.86.41
    Server software: Apache
    Technology: Html
  9. goevi.de
    Höst (Germany) - 80.237.132.229
    Server software: Apache
    Technology: Html
  10. 粤客通-网上购票-官方网站
    Jinan (China) - 123.135.128.177
    Server software: Apache-Coyote/1.1
    Technology: Html, Html5, Javascript, jQuery Cookie, Php
    Number of Javascript: 4
    Number of meta tags: 1

Check Other Websites